PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G124700.1.p
Common NameLOC101785804, SETIT_001230mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 487aa    MW: 51223 Da    PI: 5.5638
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G124700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.3e-31265320156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFv+a++ LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Seita.5G124700.1.p 265 KARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 320
                         68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-17262323IPR009057Homeodomain-like
PROSITE profilePS5129413.69262322IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-28263323IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-26265320IPR006447Myb domain, plants
PfamPF002491.0E-6267318IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MASSASDLTL DYKPNGNSNG GGAYAVIPKQ QQETLVDGHH LTTEQTTQKL REFLARLEEE  60
RLKIDAFKRE LPLCMHLLNH AMEAYGQQLE AYQMGSLQGA PARPLVLEEF IPLKKIGIDA  120
AADKMGNQPS EKASWMESAQ LWNGPGAALA AADTAAKGPQ TPKESSEHQL PIDTLGALDT  180
AAGQRNGGAF LPFAKDKAAA EAAALPELAL APAEKDAAET DRKPYLDAAG ANGGLGARRD  240
VQNGVKPASN ATDGQAPPPP QTHRKARRCW SPELHRRFVN ALQILGGAQV ATPKQIRELM  300
KVDGLTNDEV KSHLQKYRLH TRRPMPTPPA PATAAPQLVV LGGIWVPPEY ATQAAGQAIY  360
GAHPATQPHY TAAVAAAQEY YPPPAAVHHL QHHPAAAMVH HRAAAPPPPQ AAAYKAAMAG  420
SPPESSEGLG SAGGGSVGGG GGRERSESIE DEDEGEERED DGDDDDDVPA AKTDGEDSTG  480
AAAIKY*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0865720.0BT086572.2 Zea mays full-length cDNA clone ZM_BFc0184N23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968400.10.0PREDICTED: probable transcription factor GLK2
TrEMBLK3XH590.0K3XH59_SETIT; Uncharacterized protein
STRINGSi001230m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.16e-69G2-like family protein